PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010111176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HB-other
Protein Properties Length: 1970aa    MW: 220775 Da    PI: 5.0023
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010111176.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-18223278257
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      kR+  t+ qle+Le++++ + yps++ r+eL++klgL++rq ++WF+ rR k+kk
  XP_010111176.1 223 PKRQMKTPFQLETLEKAYALEAYPSESIRAELSEKLGLSDRQLQMWFCHRRLKDKK 278
                     69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-19201278IPR009057Homeodomain-like
SuperFamilySSF466892.87E-16208278IPR009057Homeodomain-like
PROSITE profilePS5007116.439219279IPR001356Homeobox domain
SMARTSM003895.8E-18221283IPR001356Homeobox domain
PfamPF000466.9E-16223278IPR001356Homeobox domain
CDDcd000863.30E-14224278No hitNo description
PROSITE profilePS5082716.451746805IPR018501DDT domain
SMARTSM005711.1E-21746805IPR018501DDT domain
PfamPF027912.7E-17747802IPR018501DDT domain
PfamPF050662.9E-15928996IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.4E-811611205IPR028942WHIM1 domain
PfamPF156133.4E-1313461418IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1970 aa     Download sequence    Send to blast
MQFEDEWYLM HKAINVIRHG GGNVNERVFE CISLIDICNP LMLVDCSLSG RGPADVAQIE  60
NSNPRSERGF SITSGRRVVS LMFQRLGGSG THGFAISCWQ LVVTTRGPRV PVNRQRVPMS  120
CKRLSSVELA AAPAATRNNL GGEVIGFDGR RLCSFDVGLN SRILEVEEDE FLLGSRSSAS  180
MEGVSEGENQ NNNDSSNNNH NHTPNNNNGG SKGNNSNEGH SKPKRQMKTP FQLETLEKAY  240
ALEAYPSESI RAELSEKLGL SDRQLQMWFC HRRLKDKKDG GPAKKPRKMV PALPESPIDE  300
LRAGPPELGS DYGSGSGSGS SPFGPAELRN VVSRGLADDL PPMGRRYYEP RQSMLELRAI  360
AIVEAQLGKP LREDGPVLGI EFDTLPPDAF GAPLVFFVGA VAEQQKRSGH PFEGKSYERH  420
EKLNKATART LHEYPFLPEP STSRTDVYGH VAPSHIHNSA LDGPTARSSS FAVSNEQLPR  480
IHGNQGHASR VRLSQQDKQG VSFPLPPVDD NCLPQKDPFT NTKVNSQISE HPVISPENSY  540
MLSDGQILAN DTVLRLERKR KCEEARIAKE VEAHEIRIRK ELEKQDNLRR KHEERLRKEM  600
ERQDRERRKE EERLMREKQR EEDRLRREQR REMERREKFL QKECLRAEKR RLKEELRKER  660
EAVRRKAAIE KATARKIARE SMELIEDEQL ELMEMAVSRK GLSSIISLDH DTMQNLESFR  720
DFLGAFPPKS VQLKSPFAVQ PWINLEENIG NLLMVWRFFI TFADVLELWP FTLDEFVQAF  780
HDYDSRLLGE IHVALLKLII KDIEDVARTP SSGLGMSQNG AANPGGGHPE IVGGAYTWGF  840
DIRNWQQHLN PLTWPEIFRQ LALSAGFGPQ LKKRSMAWSY LPDNNEGKSS EDAISTLRSG  900
SAAENAFAIM QEKGLLLPRR SRHRLTPGTV KFAAFHVLSL EGSKGLTVLE LADKIQKSGL  960
RDLTTSKTPE ASISVALTRD TKLFERIAPS TYRVRAAYRK DPADAEAILS AARKKVQIFE  1020
NGFLAAEDAD EVERDEDSEC DDVDEDPEVD DLATPSSANI VTENYNEVNP EVDDLATPSS  1080
ANIVTENYNE VNPCSRSGKE NLCDDVALDL QNEFDKDSAS IPLSDSKDVN CPSALPEQFV  1140
ASEDAGGGNP DEENMEIDES KSGESWIQGL TEGEYSDLSV EERLNALVAL VGIANEGNSI  1200
RVVLEDRLEA ANALKKQMWA EAQLDKSRLK EENITKLDFP SFVGGKTEMH LARSAAEGSQ  1260
SPLPDINNRN TDLSPSVAES KKSVHDLNSV QNDLNSLPTE KTLVAQDFST GPDNFLAQQL  1320
AFASKRSRSQ LKSYIAHRAE EMYVYRSLPL GQDRRRNRYW QFVASASSND PGSGRIFVEL  1380
HDGNWRLIDT EEAFDALLMS LDTRGIRESH LRLMLQKIET SFRSVQSSSI TGRGLSIVKR  1440
ETDETSPDSR ANFDSPGSTI CGLNSDSDLV ETSSSFRIEL GRNETEKKAA LRRYQDFQKW  1500
MLEECKNSST LHAMKCGKMR CRQRLEICDF YLGLYSLEDS HCFSCHQTFS NSGNDLSRHA  1560
IQCKERSKSD FVDTSFPFGM RLLKALLALI EVSVPQEALQ SFWMGDRGKT WGVKLNASSS  1620
SEQLLQILTL FESVIKQDFL SSNYSTTEEL LGPCNQSGTS LHNISDPASV PVLPWIPQTI  1680
AAVALRLFDL DASIAYVPEE KPEPIEDKDK ELGEYIKLPT RFAPSRNDKE IELTELNYNA  1740
HVKEENRSQL KSSRNNYKRG RGAREQGRSK KLQRRVNGSK PGASRRNAMV NDNVIEGLRQ  1800
PGRKALKQGG VRGRRTVRKR RTGNKKVEET LPVHMPDIPS SPESGGESPR ILAEEWDDDN  1860
VNATPTKDDD NIVGEEEAME SDDNAQEEEY EQENWEVGYN GVSNKWNEGR MMEASDEDVD  1920
AYDEDDNGME GVGDGESEGD VDVSEESDDM PNRIENDQGS DSEVSDDYSD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1271278RRLKDKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-46AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111176.10.0Homeobox protein 10
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLW9SHQ20.0W9SHQ2_9R
STRINGGLYMA13G30860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1